DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and pla2g3

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_031747444.1 Gene:pla2g3 / 105946306 XenbaseID:XB-GENE-6086963 Length:370 Species:Xenopus tropicalis


Alignment Length:211 Identity:66/211 - (31%)
Similarity:99/211 - (46%) Gaps:29/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTF 157
            |..::.||  ..|||.|||.|::|.::.:||.....|.||||||.|...:...:.:.|:.|....
 Frog    29 GDRYKRGL--TMPGTLWCGAGSSADNFTNLGIFNGADLCCREHDHCSHQIEAFQFQYGMRNYRLH 91

  Fly   158 TRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCF--QERSPCSAHQRFEDFYY----RTD 216
            |.||||||.|||.||.|.|...:..:|.:|:|::::.||  :|...|     .|.|::    :.|
 Frog    92 TVSHCDCDQRFRLCLNAFNDTISTLVGIMFFNILEMPCFSLKEEEQC-----VEWFWWGGCKKFD 151

  Fly   217 HCP-AEFRQADLYVPPHGDNLIAKI-LAHPQGRALAAPSWTIPAKSTARRWGVKLASVGLAAVNI 279
            ..| ||.::...:...|...|.|.. .:|.......:|..|....|.:..:|      |:|.   
 Frog   152 LVPKAELQKQAFFNNTHPMGLQASTDSSHEPTLVATSPRQTEAPSSFSTVFG------GIAK--- 207

  Fly   280 LREVVQRPRLLWDSLQ 295
                 :|.|||.:.||
 Frog   208 -----KRRRLLKNKLQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 39/97 (40%)
pla2g3XP_031747444.1 Phospholip_A2_2 38..132 CDD:399082 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6992
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5827
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.