DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and LOC101885160

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005169114.1 Gene:LOC101885160 / 101885160 -ID:- Length:463 Species:Danio rerio


Alignment Length:208 Identity:68/208 - (32%)
Similarity:93/208 - (44%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLFLWLGSAMPPTSGSAVLISDMTMSVMVELSSRHPFCKMHTDR------GDIQR----MLLQSD 67
            |||.| ....|........||.....:...||    ||  |.:|      |...|    .||:.|
Zfish    58 LLFYW-SKWTPDQRVKECFISRDVSQIQRYLS----FC--HEERIIWDSDGKFSRYNLTALLEDD 115

  Fly    68 PRRIRQVPRESVMELEEVCRRQGSYGH---EFRGGLGFIYPGTKWCGPGTAATSYDDLGAHARED 129
            ......:...|.:.|.|...:|.....   :.|....::.|||.|||.||.|..|:.||.....|
Zfish   116 GLCQINLNINSSLTLREENAKQNQQMDSRVKIRSKRAWVLPGTLWCGRGTNANDYEQLGMFEHAD 180

  Fly   130 RCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVT 194
            |||||||.|..::.......|:.|...||.||||||.||::||...|...:|.:|..|:||:::.
Zfish   181 RCCREHDHCEHIIRSFSVNFGVFNPTFFTVSHCDCDHRFKQCLLGGNDTISNMVGYSFFNVLKIR 245

  Fly   195 CFQ--ERSPCSAH 205
            ||:  :|..|:.:
Zfish   246 CFEFIQRRQCTQY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 43/97 (44%)
LOC101885160XP_005169114.1 Phospholip_A2_2 155..249 CDD:283483 43/93 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6656
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11907
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.