DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and proca1

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_009289846.1 Gene:proca1 / 100149324 ZFINID:ZDB-GENE-110418-1 Length:729 Species:Danio rerio


Alignment Length:118 Identity:46/118 - (38%)
Similarity:61/118 - (51%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCD 165
            ||.||||.|||.|..|..|:.||.....|||||.||.||.|::......|..|....:.||||||
Zfish   151 GFTYPGTLWCGAGNIADHYEQLGEFEETDRCCRVHDHCPYVIHAFSSNYGYTNFKWHSLSHCDCD 215

  Fly   166 ARFRRCLQAANTETANTLGAIFYNVVQVTCFQ--------ER---SPCSAHQR 207
            ...:.||:..|..::..:|..|:||::|.||:        ||   ..|..::|
Zfish   216 NALKECLRLVNDTSSRVVGQAFFNVIEVPCFEFSFEEQCVERHWYGVCKKYER 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 41/103 (40%)
proca1XP_009289846.1 PLA2_bee_venom_like 152..248 CDD:153093 41/95 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.