DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and proca1

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_031752533.1 Gene:proca1 / 100145034 XenbaseID:XB-GENE-1005546 Length:526 Species:Xenopus tropicalis


Alignment Length:244 Identity:70/244 - (28%)
Similarity:98/244 - (40%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TDRGDIQRMLLQSDPRRIR---QVPRESVMELEEVCRRQGSYG------HEFRGG---------- 99
            ||..::......||.|.:.   ....|.|..|...|.|:...|      .||.|.          
 Frog   101 TDGRELVSSTWDSDSRLLSCSVSEDEEEVGSLFSRCSRKSQQGAGAVGLEEFAGAKLACEFSLRA 165

  Fly   100 ------------------LGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGE 146
                              .||.||||.|||.|..|.:::|||.|...|.|||.||.|..|::...
 Frog   166 AESGGQTTPAEPELRRVKRGFTYPGTLWCGAGNNAETFEDLGEHTATDACCRTHDHCAHVIHPFS 230

  Fly   147 CRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ--ERSPCSAHQRFE 209
            .|.|..|....|.|||.||.:|:.||:..|...:..:|..||||::|.||:  .:|.|     .|
 Frog   231 YRYGYRNYLWHTISHCQCDTQFKDCLRRVNDTASRVVGQAFYNVIKVPCFEFMYKSQC-----VE 290

  Fly   210 DFYY-----RTDHCPAEFRQADLYVPPHGDNLIAKILAHPQGRALAAPS 253
            .::|     ..:...|..:.:.||  ..|.:||.::....:.....||:
 Frog   291 RYWYGWCKTYNNESVAVPKDSGLY--DFGGDLIDQVSNEKEESPTQAPA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 43/97 (44%)
proca1XP_031752533.1 PLA2_bee_venom_like 186..282 CDD:153093 43/95 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6992
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.