DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and HSP93-III

DIOPT Version :9

Sequence 1:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001325472.1 Gene:HSP93-III / 824048 AraportID:AT3G48870 Length:952 Species:Arabidopsis thaliana


Alignment Length:230 Identity:49/230 - (21%)
Similarity:99/230 - (43%) Gaps:41/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ARIDELERSLERTLIGQHIVRQHIVPAL-KAHIASGNKSRKPLVISFHGQPGTGKNFVAEQIADA 124
            :|:.::|::|...:|||....:.|..|: :|.:...|.:|......|.|..|.||:.:|:.:  |
plant   618 SRLLQMEQTLHTRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKAL--A 680

  Fly   125 MYLKGSRSNYVTKYLGQADFPKESEVSNYRVKI------------NNAVRDTLRSCPRSLFIFDE 177
            .|..||....:.  |..::|.:...||    |:            ...:.:.:|..|.:|.:|||
plant   681 AYYFGSEEAMIR--LDMSEFMERHTVS----KLIGSPPGYVGYTEGGQLTEAVRRRPYTLVLFDE 739

  Fly   178 VDKMPSGVFDQLTSLVDYNAFVDGTDNT---KAIFIFLSNTAGSHIASHLGSVMKNGRLREDTRL 239
            ::|....||:.:..:::.....|....|   |...:.:::..||.:      :.|.||     |:
plant   740 IEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSV------IEKGGR-----RI 793

  Fly   240 S-DFEPLLRKAAYNMDGGMKKTTMIESHVIDHFIP 273
            . |.:...:.::||     :..:::...:..:|.|
plant   794 GFDLDHDEKDSSYN-----RIKSLVTEELKQYFRP 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 29/126 (23%)
AAA 100..224 CDD:214640 29/138 (21%)
HSP93-IIINP_001325472.1 clpC 114..929 CDD:214361 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.