DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and tor1l2

DIOPT Version :9

Sequence 1:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001373410.1 Gene:tor1l2 / 556854 ZFINID:ZDB-GENE-121107-3 Length:324 Species:Danio rerio


Alignment Length:280 Identity:97/280 - (34%)
Similarity:154/280 - (55%) Gaps:15/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LERSLERTLIGQHIVRQHIVPALKAHIASGNKSRKPLVISFHGQPGTGKNFVAEQIADAMYLKGS 130
            ||:.|...|.||||....|:.::.:.: :.:|..||||:|.||..|||||.|.:.:|..:|.||.
Zfish    52 LEKDLNDFLFGQHIASNVILKSVSSFM-TDSKPNKPLVLSLHGTTGTGKNHVTKILARNIYKKGE 115

  Fly   131 RSNYVTKYLGQADFPKESEVSNYRVKINNAVRDTLRSCPRSLFIFDEVDKMPSGVFDQLTSLVDY 195
            .|.:|..|:.:.:||...:|..|..::...:...:.|.|||:|||||:|||...:.|.|...:||
Zfish   116 ESKHVQIYVSEYNFPDRGKVDLYTAQLRQWIYGNVSSFPRSMFIFDEMDKMQPQLIDVLKPFLDY 180

  Fly   196 NAFVDGTDNTKAIFIFLSNTAGSHIASHLGSVMKNGRLREDTRLS--DFEPLLRKAAYN-MDGGM 257
             :.|:|.....||||||||..|..||.......:.|:.|||..::  :.|..:....|| .:.|.
Zfish   181 -SLVNGVSFHNAIFIFLSNAGGKVIADLALDFWREGKNREDLWMNSRELEIKISTNVYNDKNCGF 244

  Fly   258 KKTTMIESHVIDHFIPFLPMEKAHVIKCLEAELLRWRRDPKQAN---NQKIIEDIINSSISYDRT 319
            ..|::|:.|:|||||||||:|..||.:|:.||:       |..|   :.::.:::......:...
Zfish   245 LHTSIIDEHLIDHFIPFLPLELKHVRQCVLAEM-------KHLNITKDDELADEVARDMPYFPEE 302

  Fly   320 HSLFAISGCKTLEKKVAMAI 339
            ..:||:.|||::.:|:.:.:
Zfish   303 ERIFAVKGCKSVRQKLVLHV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 39/108 (36%)
AAA 100..224 CDD:214640 53/123 (43%)
tor1l2NP_001373410.1 ClpA <40..293 CDD:223616 91/249 (37%)
Torsin 42..160 CDD:399367 39/108 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580529
Domainoid 1 1.000 105 1.000 Domainoid score I6569
eggNOG 1 0.900 - - E1_KOG2170
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3879
OMA 1 1.010 - - QHG49139
OrthoDB 1 1.010 - - D1453168at2759
OrthoFinder 1 1.000 - - FOG0001199
OrthoInspector 1 1.000 - - otm24793
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X455
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.