DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and TOR4A

DIOPT Version :9

Sequence 1:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_060193.2 Gene:TOR4A / 54863 HGNCID:25981 Length:423 Species:Homo sapiens


Alignment Length:339 Identity:77/339 - (22%)
Similarity:127/339 - (37%) Gaps:86/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTIGAVGAVALGAYFKEHTYCRFAECCDDRNIPARIDELERSLERTLIGQHIVRQHIVPALKAHI 92
            |.:..||...|.|          .|..||......:|.||::|:|.:.||......||..::.::
Human   125 LLVAIVGFQVLNA----------IENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYL 179

  Fly    93 ASGNKSRKPLVISFHGQPGTGKNFVAEQIADAMYLKGSRSNYVTKYLGQADFPKESEVSNYRVKI 157
            |:...|| ||:::.||..|.||:.|...:|.........|..|.:|..:...|:.....:.|.::
Human   180 ATHVHSR-PLLLALHGPSGVGKSHVGRLLARHFRSVLEDSALVLQYHARHHCPEARAAQDCREEL 243

  Fly   158 NNAVRDTLRSCPRS----LFIFDEVDKMPSGVFDQLTSLVD-------YNAFVDGTDNTKAIFIF 211
            ...|.|.:......    |.:.|:|:.||..:.|:|...:.       :|          ||::.
Human   244 ARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQPQRSHHFHN----------AIYVL 298

  Fly   212 LSNTAGSHIASHLGSVMKN-------------------GRLREDTR------LSDFEPLLRKAAY 251
            ||...|:.:...   |::|                   .:..||.|      ||...||.:.|| 
Human   299 LSGAGGAEVTRF---VLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWQAAA- 359

  Fly   252 NMDGGMKKTTMIESHVIDHFIPFLPMEKAHVIKCLEAELLRWRRDPKQANNQKIIEDIINSSISY 316
                               .:|||.::|..|:.|...|:......|.||..:.:.     :.:|:
Human   360 -------------------IVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLA-----AQLSF 400

  Fly   317 DRTHSL-FAISGCK 329
            .|.... ||::|||
Human   401 YRVAGREFAVTGCK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 32/130 (25%)
AAA 100..224 CDD:214640 29/134 (22%)
TOR4ANP_060193.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..68
P-loop_NTPase 149..253 CDD:304359 28/104 (27%)
AAA 186..>290 CDD:214640 24/104 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.