DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and CG4880

DIOPT Version :10

Sequence 1:NP_572178.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_573177.1 Gene:CG4880 / 32680 FlyBaseID:FBgn0030803 Length:351 Species:Drosophila melanogaster


Alignment Length:261 Identity:50/261 - (19%)
Similarity:88/261 - (33%) Gaps:84/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KESEVS----NYRVKINNAVRDTLRSCPRSLFIFDEVDKMPSGVFDQLTSLVDYNAFVDGTDNTK 206
            |.|.||    :|:.:.::.|.:....|..|..:.|.|......|.:|..:|......:|.|.|..
  Fly    85 KLSTVSGFLESYKNQYHSIVHNQDNYCNPSRRLGDMVLHARHQVLNQDLALNQLELALDNTTNEA 149

  Fly   207 AIFIFLSNTAGSHIA---------------------SHLGSVM----------KNGRLREDTRLS 240
            .:.:..|....||.|                     |.||.|.          :|..|.::....
  Fly   150 IVLVGTSGVGKSHTARILRETFPWPENVNTLSWTGSSSLGRVKSMLSGLTYCGQNMILIDNMTPK 214

  Fly   241 D--FEPLL--------RKAAYNMDGGMKKTTMI-----------ESHVID----------HFIPF 274
            |  |.|::        :.|.:......|:.|::           |...:|          ..:.|
  Fly   215 DAHFVPIINEMISEGEKSANHTEHPQQKRLTIVFIFNVNSMQPGEEFEMDMEILRNMPHTQLVTF 279

  Fly   275 LPMEKAHVIKCLEAELLRWRRDPKQAN---NQKIIEDIINSSISYDRTHSLFAISGCKTLEKKVA 336
            ..::..|::.|:       ||:...|.   ..:.:|:||.|..:        :.||||::..||.
  Fly   280 ATLDPTHLVDCI-------RREAAIAMVHLEDEHVEEIIKSIDA--------SASGCKSILAKVL 329

  Fly   337 M 337
            :
  Fly   330 L 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_572178.1 P-loop containing Nucleoside Triphosphate Hydrolases 55..175 CDD:476819 8/32 (25%)
CG4880NP_573177.1 P-loop containing Nucleoside Triphosphate Hydrolases 131..>181 CDD:476819 9/49 (18%)

Return to query results.
Submit another query.