DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and Tor2a

DIOPT Version :9

Sequence 1:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001356151.1 Gene:Tor2a / 30933 MGIID:1353596 Length:322 Species:Mus musculus


Alignment Length:327 Identity:97/327 - (29%)
Similarity:170/327 - (51%) Gaps:25/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVLVILPLPLQSVDPLTIGAVGAVALGAYFKEHTYCRFAECCDDRNIPARIDELERSLERTLIGQ 77
            |:|.:|.|.|.:.....:.::..          |:..|.||....::|....|..|:     .||
Mouse    13 SILGLLGLALAAAAAWDVASLRC----------TFGSFCECDFWPDLPGEGWEPVRT-----GGQ 62

  Fly    78 HIVR---QHIVPALKAHIASGNKSRKPLVISFHGQPGTGKNFVAEQIADAMYLKGSRSNYVTKYL 139
            ..||   :|:.|  :...|......||||:|.||..||||::|:..:|..::..|.||.:|..:.
Mouse    63 PAVRRGSKHLPP--RRPPAEDPAPSKPLVLSLHGWTGTGKSYVSSLLAQHLFRDGLRSPHVHHFS 125

  Fly   140 GQADFPKESEVSNYRVKINNAVRDTLRSCPRSLFIFDEVDKMPSGVFDQLTSLVDYNAFVDGTDN 204
            ....||..|....|:.::.:.|:..|.:|.||||:|||:||:|.|:.:.|...:..:..|.||:.
Mouse   126 PIIHFPHPSRTEQYKKELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVLQPFLGPSWVVYGTNY 190

  Fly   205 TKAIFIFLSNTAGSHIASHLGSVMKNGRLREDTRLSDFEPLLRKAAY-NMDGGMKKTTMIESHVI 268
            .||||||:||..|..|........::.|.||:..|.:.||::.:|.. |...|..::.::|.|::
Mouse   191 RKAIFIFISNAGGEQINQVALEAWRSHRDREEISLQEVEPVISRAVMDNPQHGFWRSGIMEEHLL 255

  Fly   269 DHFIPFLPMEKAHVIKCLEAELLRWRRDPKQANNQKIIEDIINSSISYDRTHSLFAISGCKTLEK 333
            |..:||||:::.||..|:..||.:...:|    ::::::.:::|:..:.....||:.:||||:..
Mouse   256 DAVVPFLPLQRHHVRHCVLNELAQLGLEP----SEEVVQAVLDSTTYFPEVEQLFSSNGCKTVAS 316

  Fly   334 KV 335
            ::
Mouse   317 RL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 41/129 (32%)
AAA 100..224 CDD:214640 49/123 (40%)
Tor2aNP_001356151.1 Torsin 35..161 CDD:148114 42/142 (30%)
ClpA <155..294 CDD:223616 47/142 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836992
Domainoid 1 1.000 102 1.000 Domainoid score I6803
eggNOG 1 0.900 - - E1_KOG2170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3732
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001199
OrthoInspector 1 1.000 - - otm42470
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.