DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Torsin and LOC100006542

DIOPT Version :9

Sequence 1:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_001345255.4 Gene:LOC100006542 / 100006542 -ID:- Length:181 Species:Danio rerio


Alignment Length:197 Identity:63/197 - (31%)
Similarity:100/197 - (50%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSFPRMLSLCLSVLVILPLPLQSVDPLTIGAVGAVALGAYFKEHTYCRFAECCDDRNI--PARID 64
            |...|:|:..|.|..|    ..|:..|.:....|.|:..:|::          ||..:  |.|  
Zfish     1 MKAQRILTALLLVCNI----TSSLCFLEVFTDAASAVYTFFEQ----------DDLLVFDPKR-- 49

  Fly    65 ELERSLERTLIGQHIVRQHIVPALKAHIASGNKSRKPLVISFHGQPGTGKNFVAEQIADAMYLKG 129
             ||..|...|.||||....::.::.:.: :.:|..||||:||||..|||||.|.:.:|..:|.||
Zfish    50 -LEEDLNDFLFGQHIASNVVLKSVSSFM-TDSKPNKPLVLSFHGTTGTGKNHVTKILARNIYKKG 112

  Fly   130 SRSNYVTKYLGQADFPKESEVSNYRVKINNAVRDTLRSCPRSLFIFDEVDKMPSGVFDQLTSLVD 194
            ..|.:|..|..:..||:.|::..|..::...:...:.|.|||:|||||:::|...:.|.|...:|
Zfish   113 EESKHVQIYDLEHHFPQRSKIDLYSAQLKQWIHGNVSSFPRSMFIFDEMEEMQPELIDVLKPFLD 177

  Fly   195 YN 196
            |:
Zfish   178 YS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 43/128 (34%)
AAA 100..224 CDD:214640 39/97 (40%)
LOC100006542XP_001345255.4 P-loop_NTPase 34..158 CDD:304359 44/137 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453168at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.