DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and MRPL33

DIOPT Version :10

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_014013.1 Gene:MRPL33 / 855330 SGDID:S000004899 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:84 Identity:27/84 - (32%)
Similarity:38/84 - (45%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNARLWKIKHLIKVTPVTFPYGEPT 122
            ::|...:.|.|.|:....|:|.||| ||:......|..|.....|.|:|.|:|| .||.....|:
Yeast     4 YKVTLSRSLIGVPHTTKSIVKSLGL-GKRGSIVYKKVNPAIAGSLAKVKELVKV-EVTEHELTPS 66

  Fly   123 AQDVRHTILKENGECLVTK 141
            .|   ..:.|.|...:|.|
Yeast    67 QQ---RELRKSNPGFIVEK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 17/51 (33%)
MRPL33NP_014013.1 Ribosomal_L30 4..57 CDD:100100 19/54 (35%)

Return to query results.
Submit another query.