DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and mrpl30

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001018597.1 Gene:mrpl30 / 553799 ZFINID:ZDB-GENE-050522-240 Length:154 Species:Danio rerio


Alignment Length:120 Identity:43/120 - (35%)
Similarity:63/120 - (52%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QKFEGITYYPRTPDHQ---DPPVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKN 94
            |.||     .|..:|.   ..|.:|.||..|.|:|.....||||.:::|.||| .|..:..|.||
Zfish    37 QVFE-----ERAKEHDKYGGDPEQPHKLHIVTRVKSTMRRPYWEKKVVKSLGL-MKSHEPRVHKN 95

  Fly    95 IPENNARLWKIKHLIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPIDTR 149
            .|..|..|..||||:::.|:..|:|.|..:|:.:|.|...||.:|.:.|.|::.:
Zfish    96 TPSVNNLLKIIKHLVRIEPLKLPHGLPAEEDMANTHLNSRGELVVKRLLKPLEKK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 22/51 (43%)
mrpl30NP_001018597.1 Ribosomal_L30 60..113 CDD:100100 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5286
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446797at2759
OrthoFinder 1 1.000 - - FOG0007333
OrthoInspector 1 1.000 - - oto41094
orthoMCL 1 0.900 - - OOG6_107209
Panther 1 1.100 - - LDO PTHR15892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5849
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.