DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and mrpl30

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_012812384.1 Gene:mrpl30 / 548902 XenbaseID:XB-GENE-945512 Length:194 Species:Xenopus tropicalis


Alignment Length:156 Identity:56/156 - (35%)
Similarity:82/156 - (52%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KKFLYKNGQKFEGITYYP-----------------RTP---------DHQ---DPPVEPAKLFRV 60
            :||:.||....:.::.||                 |.|         ||:   ..|.:|.||..|
 Frog    38 RKFVQKNTFHSKCLSEYPGLSLTWSFWIRHKFTKSRIPDEVLQPQPGDHEKYGGDPQQPHKLHLV 102

  Fly    61 QRIKPLKGNPYWENRILKDLGLDGKQSDFTVV-KNIPENNARLWKIKHLIKVTPVTFPYGEPTAQ 124
            .|||...|.||||.:.|:.|||  :::..||| ||||..||:|..:|||::|.|:..|:|.|:.:
 Frog   103 TRIKSGVGRPYWEKKTLELLGL--QKAHKTVVHKNIPAVNAKLKTVKHLVRVQPLKLPHGLPSEE 165

  Fly   125 DVRHTILKENGECLVTKDLGPIDTRL 150
            |:..|.||.:||.::.|.|.|.:|:|
 Frog   166 DISDTFLKSSGELVIRKRLQPTETKL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 26/52 (50%)
mrpl30XP_012812384.1 Ribosomal_L30 100..153 CDD:100100 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12065
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I4976
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446797at2759
OrthoFinder 1 1.000 - - FOG0007333
OrthoInspector 1 1.000 - - oto103518
Panther 1 1.100 - - LDO PTHR15892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5849
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.