DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and MRPL30

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_660213.1 Gene:MRPL30 / 51263 HGNCID:14036 Length:161 Species:Homo sapiens


Alignment Length:107 Identity:44/107 - (41%)
Similarity:61/107 - (57%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DHQ---DPPVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNARLWKIKH 107
            ||:   ..|..|.||..|.|||..:..||||..|:|.|||: |.....|.||||..||:|..:||
Human    52 DHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLE-KAHTPQVHKNIPSVNAKLKVVKH 115

  Fly   108 LIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPIDTR 149
            ||::.|:..|.|.|..:::.:|.||..||.:|...|.|::.:
Human   116 LIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 26/51 (51%)
MRPL30NP_660213.1 Ribosomal_L30 67..119 CDD:100100 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12172
eggNOG 1 0.900 - - E1_KOG4799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446797at2759
OrthoFinder 1 1.000 - - FOG0007333
OrthoInspector 1 1.000 - - oto89705
orthoMCL 1 0.900 - - OOG6_107209
Panther 1 1.100 - - LDO PTHR15892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5849
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.