DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and Mrpl30

DIOPT Version :10

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001100373.1 Gene:Mrpl30 / 301352 RGDID:1308196 Length:160 Species:Rattus norvegicus


Alignment Length:111 Identity:45/111 - (40%)
Similarity:60/111 - (54%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YYPRTPDHQ---DPPVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNAR 101
            :.||..||:   ..|..|.||..|.||:..|..||||...:|.|||....|. .:.||||..||:
  Rat    46 FQPRPEDHEKYGGDPQNPHKLHIVTRIRSTKRRPYWEKDTIKMLGLQKAHSP-QIHKNIPSVNAK 109

  Fly   102 LWKIKHLIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPID 147
            |..:||||::.|:..|.|.||.:.:..|.||..||.:|...|.|::
  Rat   110 LKVVKHLIRIQPLKLPQGLPTEETMSSTCLKSTGELVVQWHLKPVE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 24/51 (47%)
Mrpl30NP_001100373.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..64 5/17 (29%)
Ribosomal_L30 67..120 CDD:100100 24/53 (45%)

Return to query results.
Submit another query.