DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and mrpl33

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_588490.1 Gene:mrpl33 / 2539139 PomBaseID:SPCC1919.08c Length:97 Species:Schizosaccharomyces pombe


Alignment Length:57 Identity:17/57 - (29%)
Similarity:26/57 - (45%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNARLWKIKHLIKVTPV 114
            |||:..:...|.......:|..|.|..:.|......| |.|..|::|:|.|:.|:.|
pombe     4 FRVRLERSAIGLSSKVRSVLHSLRLTKRHSVVYCDVN-PINAGRIFKVKELVSVSTV 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 14/51 (27%)
mrpl33NP_588490.1 Ribosomal_L30 4..56 CDD:100100 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15892
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.