powered by:
Protein Alignment mRpL30 and mrpl33
DIOPT Version :9
Sequence 1: | NP_525073.1 |
Gene: | mRpL30 / 31398 |
FlyBaseID: | FBgn0029718 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_588490.1 |
Gene: | mrpl33 / 2539139 |
PomBaseID: | SPCC1919.08c |
Length: | 97 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 57 |
Identity: | 17/57 - (29%) |
Similarity: | 26/57 - (45%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 FRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNARLWKIKHLIKVTPV 114
|||:..:...|.......:|..|.|..:.|......| |.|..|::|:|.|:.|:.|
pombe 4 FRVRLERSAIGLSSKVRSVLHSLRLTKRHSVVYCDVN-PINAGRIFKVKELVSVSTV 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15892 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.