DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and mrpl-30

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_497550.1 Gene:mrpl-30 / 175359 WormBaseID:WBGene00021021 Length:197 Species:Caenorhabditis elegans


Alignment Length:153 Identity:50/153 - (32%)
Similarity:73/153 - (47%) Gaps:13/153 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KKFLY-KNGQKFEGITYYPRTPDHQDPPVEPAKLFRVQRIKPLKGNPYWENRILKDL-GLDGKQS 87
            |:|.| |||   ..:.:|......:..|.:.:||:.....:.....|.|..:.:::| |.|.|..
 Worm    29 KEFDYDKNG---ASLKHYTEEISEEMRPKQASKLWMAWLYRDTSAEPKWTKKHVENLFGADFKVG 90

  Fly    88 DFTVVKNIPENNARLWKIKHLIKVTPVTFPYG-EPTAQDVRHTILKENGECLVTKDLGPI----D 147
            ...|.:|....|..||||||||::.||.|..| |||..|:..|.|..||:|.|.:. |.:    |
 Worm    91 RMEVFRNTELINTELWKIKHLIELRPVEFKNGVEPTEDDIFSTSLAPNGQCEVIQG-GHVASEND 154

  Fly   148 TRLAARQDYDEQPKRLDTDLLRK 170
            .:||..:.:..  |.|..||.:|
 Worm   155 LKLADGKQWTR--KELGRDLNKK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 17/52 (33%)
mrpl-30NP_497550.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4799
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446797at2759
OrthoFinder 1 1.000 - - FOG0007333
OrthoInspector 1 1.000 - - oto18200
orthoMCL 1 0.900 - - OOG6_107209
Panther 1 1.100 - - LDO PTHR15892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5849
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.