DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL30 and Mrpl30

DIOPT Version :9

Sequence 1:NP_525073.1 Gene:mRpL30 / 31398 FlyBaseID:FBgn0029718 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001343411.1 Gene:Mrpl30 / 107734 MGIID:1333820 Length:160 Species:Mus musculus


Alignment Length:111 Identity:44/111 - (39%)
Similarity:60/111 - (54%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YYPRTPDHQ---DPPVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNAR 101
            :.|:..||:   ..|..|.||..|.||:..|..||||...:|.|||....|. .:.||||..||:
Mouse    46 FQPKPEDHEKYGGDPQNPHKLHIVTRIRSTKRRPYWEKDTIKMLGLQKAHSP-QIHKNIPSVNAK 109

  Fly   102 LWKIKHLIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPID 147
            |..:||||::.|:..|.|.||.:.:..|.||..||.:|...|.|::
Mouse   110 LKVVKHLIRIQPLKLPQGLPTEETMSSTCLKSTGELVVQWHLKPVE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL30NP_525073.1 Ribosomal_L30_like 59..111 CDD:100098 24/51 (47%)
Mrpl30NP_001343411.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..64 4/17 (24%)
Ribosomal_L30 67..120 CDD:100100 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12269
eggNOG 1 0.900 - - E1_KOG4799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5216
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007333
OrthoInspector 1 1.000 - - oto93273
orthoMCL 1 0.900 - - OOG6_107209
Panther 1 1.100 - - LDO PTHR15892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5849
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.