DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and HAND2

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_068808.1 Gene:HAND2 / 9464 HGNCID:4808 Length:217 Species:Homo sapiens


Alignment Length:161 Identity:46/161 - (28%)
Similarity:64/161 - (39%) Gaps:53/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MIGPNNPHLVNEDYA---------ASTTLDIDKRFQARMACETAAQPAPPPP----PTPAPRRRT 80
            :||  :|.:...||:         ||....:|.....      ...|...||    |.|..||.|
Human    47 LIG--HPEMSPPDYSMALSYSPEYASGAAGLDHSHYG------GVPPGAGPPGLGGPRPVKRRGT 103

  Fly    81 TPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLS 145
            .             :|:|||                   |.::.|.:|||||:.:|.:|.|.|||
Human   104 A-------------NRKERR-------------------RTQSINSAFAELRECIPNVPADTKLS 136

  Fly   146 KIEILKLAICYIAYLNHVLETPXDSAGASSF 176
            ||:.|:||..|||||..:|... .:..|.:|
Human   137 KIKTLRLATSYIAYLMDLLAKDDQNGEAEAF 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/56 (41%)
HAND2NP_068808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 14/77 (18%)
bHLH_TS_HAND2 100..161 CDD:381477 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.