DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Tcf23

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006504158.1 Gene:Tcf23 / 69852 MGIID:1934960 Length:216 Species:Mus musculus


Alignment Length:111 Identity:39/111 - (35%)
Similarity:49/111 - (44%) Gaps:34/111 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LVGLSREERR-----------------RRRRATLKYR------TAH---------ATRERIRVEA 123
            |:|..|:..|                 |..|||...|      |||         |.|||.||:.
Mouse    26 LLGTDRKRSRINRTRQDLWEDTSWSNHRLSRATSAPRGTRARGTAHGRSEASPENAARERTRVKT 90

  Fly   124 FNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVL--ETP 167
            ...:|..|:..||.:|||.||||:::|.||..|||:|...|  |.|
Mouse    91 LRQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 29/73 (40%)
Tcf23XP_006504158.1 bHLH_TS_TCF23_OUT 77..132 CDD:381552 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5363
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.