DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and TAL1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens


Alignment Length:152 Identity:48/152 - (31%)
Similarity:63/152 - (41%) Gaps:48/152 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ETAAQPAPPPPPTP-------------------------APRRR-----TTPIAHL------DPS 89
            |....|.|.|.|.|                         ||.|.     :.|:|.|      :|.
Human    92 ELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPD 156

  Fly    90 ELVGLSREERRRRRRATLKY------------RTAHATRERIRVEAFNVSFAELRKLLPTLPPDK 142
            .....:...|.:||.:..:.            |....:|||.|.:..|.:|||||||:||.||||
Human   157 AFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDK 221

  Fly   143 KLSKIEILKLAICYIAYLNHVL 164
            ||||.|||:||:.||.:|..:|
Human   222 KLSKNEILRLAMKYINFLAKLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 32/69 (46%)
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86
HLH 193..243 CDD:197674 30/49 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5161
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.