powered by:
Protein Alignment HLH4C and Scx
DIOPT Version :9
Sequence 1: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001123980.1 |
Gene: | Scx / 680712 |
RGDID: | 1588254 |
Length: | 209 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 34/69 - (49%) |
Similarity: | 44/69 - (63%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 REERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYL 160
||.|:| .||:| |||.|..:.|.:|..||.|:||.|.|:||||||.|:||..||::|
Rat 75 REPRQR--------HTANA-RERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHL 130
Fly 161 NHVL 164
.:||
Rat 131 GNVL 134
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.