DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Scx

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001123980.1 Gene:Scx / 680712 RGDID:1588254 Length:209 Species:Rattus norvegicus


Alignment Length:69 Identity:34/69 - (49%)
Similarity:44/69 - (63%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 REERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYL 160
            ||.|:|        .||:| |||.|..:.|.:|..||.|:||.|.|:||||||.|:||..||::|
  Rat    75 REPRQR--------HTANA-RERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHL 130

  Fly   161 NHVL 164
            .:||
  Rat   131 GNVL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 30/57 (53%)
ScxNP_001123980.1 bHLH_TS_scleraxis 76..143 CDD:381521 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.