DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and MESP1

DIOPT Version :10

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens


Alignment Length:110 Identity:40/110 - (36%)
Similarity:55/110 - (50%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAPPPPPTPA-PRRRTTPIAHLDPSELVGLSREERRRRRRATL--KYRTAHATRERIRVEAFNVS 127
            ||..|..:|| |.....|.|   ||  ||     ||..|.:.|  ..|.:.:.||::|:.....:
Human    47 PADSPVASPARPGTLRDPRA---PS--VG-----RRGARSSRLGSGQRQSASEREKLRMRTLARA 101

  Fly   128 FAELRKLLP--TLPPDKKLSKIEILKLAICYIAYLNHVLETPXDS 170
            ..|||:.||  ..|..:.|:|||.|:|||.||.:|:.||....:|
Human   102 LHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEES 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 23/63 (37%)
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 19/55 (35%)
bHLH_TS_Mesp 83..147 CDD:381508 24/64 (38%)
CPLCP 163..167
2 X 2 AA tandem repeats of G-Q 182..185
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.