DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and nhlh2

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_991232.1 Gene:nhlh2 / 402968 ZFINID:ZDB-GENE-040426-1809 Length:122 Species:Danio rerio


Alignment Length:93 Identity:68/93 - (73%)
Similarity:77/93 - (82%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IAHLDPSEL----------VGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPT 137
            :|| :|.|.          ..|:|||:|||||||.|||:|||||||||||||||:||||||||||
Zfish    30 VAH-EPLEADDGKTRALVPAALTREEKRRRRRATAKYRSAHATRERIRVEAFNVAFAELRKLLPT 93

  Fly   138 LPPDKKLSKIEILKLAICYIAYLNHVLE 165
            |||||||||||||:||||||:||||||:
Zfish    94 LPPDKKLSKIEILRLAICYISYLNHVLD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 52/56 (93%)
nhlh2NP_991232.1 HLH 66..116 CDD:278439 45/49 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586188
Domainoid 1 1.000 97 1.000 Domainoid score I7244
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004393
OrthoInspector 1 1.000 - - oto39784
orthoMCL 1 0.900 - - OOG6_109092
Panther 1 1.100 - - O PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3713
SonicParanoid 1 1.000 - - X3111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.