DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and twi

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:210 Identity:59/210 - (28%)
Similarity:86/210 - (40%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YDMSHMAAGPPQSISLSRYYLVDDDEMIGPNNPHLVNEDY----AASTTLDIDKRFQ--ARMACE 61
            |..|.....|..|::.|.|...|.|:|           :|    |.|:..|::....  |.:|.:
  Fly   270 YRQSFEGYEPANSLNGSAYSSSDRDDM-----------EYARHNALSSVSDLNGGVMSPACLADD 323

  Fly    62 TAAQPAPPPPPTPAPRRRTTPIAHLDPSELVGLS-REERRRRRRATLK---------YRTAHATR 116
            .:|.                  :.||.|:..|.: |:.|||.:|...|         .|.....|
  Fly   324 GSAG------------------SLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVR 370

  Fly   117 ERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLET----------PXDSA 171
            ||.|.::.|.:|..|::::||||.| |||||:.||||..||.:|..:|.:          . .|.
  Fly   371 ERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSP 434

  Fly   172 GASSFATSCLFNEAN 186
            .|...|:|.|...||
  Fly   435 SAYGSASSLLSAAAN 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 26/65 (40%)
twiNP_001033967.1 HLH 363..413 CDD:278439 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.