DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and msgn1

DIOPT Version :10

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_878302.1 Gene:msgn1 / 360135 ZFINID:ZDB-GENE-030722-1 Length:131 Species:Danio rerio


Alignment Length:97 Identity:28/97 - (28%)
Similarity:51/97 - (52%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 APRRRTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAE-LRKLLPTL 138
            :|..|::|.|..:.:       |:::.:.:.:::.|...:.||::|:.    |.|| |.:|...|
Zfish    44 SPDARSSPTAGCEHA-------EQQKPKVKMSMRRRMKASEREKLRMR----SLAEALHQLRDYL 97

  Fly   139 PP-----DKKLSKIEILKLAICYIAYLNHVLE 165
            ||     .:.|:||:.||..|.||..|:.:||
Zfish    98 PPGYSRRGQPLTKIQTLKYTIQYIKELSGILE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 21/65 (32%)
msgn1NP_878302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..79 6/41 (15%)
bHLH_TS_Msgn1 64..129 CDD:381509 21/68 (31%)

Return to query results.
Submit another query.