Sequence 1: | NP_001259243.1 | Gene: | HLH4C / 31397 | FlyBaseID: | FBgn0011277 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101428.2 | Gene: | Tal1 / 313507 | RGDID: | 1306748 | Length: | 329 | Species: | Rattus norvegicus |
Alignment Length: | 249 | Identity: | 65/249 - (26%) |
---|---|---|---|
Similarity: | 87/249 - (34%) | Gaps: | 98/249 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 MAAGPPQSISLSRYYLVDDDEMIGPN-------NPHLV---------NEDYAAST-TLDIDKRFQ 55
Fly 56 A----------------RMACETAAQ-------------PAPPPPPTPAPRR------------- 78
Fly 79 ---------------RTTPIAHL------DPSELVGLSREERRRRRRATLKY------------R 110
Fly 111 TAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVL 164 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HLH4C | NP_001259243.1 | HLH | 108..165 | CDD:238036 | 32/69 (46%) |
Tal1 | NP_001101428.2 | bHLH_TS_TAL1 | 185..249 | CDD:381549 | 32/59 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |