DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Tal1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus


Alignment Length:249 Identity:65/249 - (26%)
Similarity:87/249 - (34%) Gaps:98/249 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MAAGPPQSISLSRYYLVDDDEMIGPN-------NPHLV---------NEDYAAST-TLDIDKRFQ 55
            |...||...:.|      |.::.|..       .||||         |....|.| .:::..|..
  Rat     1 MTERPPSEAARS------DPQLEGQEAAEARMAPPHLVLLNGVTKETNRAAPAETPVIELGARSS 59

  Fly    56 A----------------RMACETAAQ-------------PAPPPPPTPAPRR------------- 78
            |                |.|..|.|:             |||.|.|..||..             
  Rat    60 AGGGPAGGGGAARDLKGRDAVATEARHRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQLSPP 124

  Fly    79 ---------------RTTPIAHL------DPSELVGLSREERRRRRRATLKY------------R 110
                           .:.|:|.|      :|......:...|.:||.:..:.            |
  Rat   125 ALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEITDGPHTKVVRR 189

  Fly   111 TAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVL 164
            ....:|||.|.:..|.:|||||||:||.||||||||.|||:||:.||.:|..:|
  Rat   190 IFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 32/69 (46%)
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 32/59 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.