DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Msc

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_008761698.1 Gene:Msc / 312897 RGDID:1305496 Length:220 Species:Rattus norvegicus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:56/143 - (39%) Gaps:48/143 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAPPPPPTPAPRRRTTPIAHLDPSE----------------LVGLSREERRRRRRAT-------- 106
            ||...||...|.|     ::..||:                .||.:...:|:|.|..        
  Rat    24 PASKRPPLLRPER-----SYASPSDNSSAEEEDPDGEEEPGTVGAAGGCKRKRPRGADASGAGGG 83

  Fly   107 -------------------LKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKL 152
                               ...|.|...|||.|:...:.:|:.|:..||.:|||.||||::.|:|
  Rat    84 AGSTGKKALPPKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRL 148

  Fly   153 AICYIAYLNHVLE 165
            |..|||:|..:|:
  Rat   149 ASSYIAHLRQLLQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 24/56 (43%)
MscXP_008761698.1 bHLH_TS_musculin 102..167 CDD:381546 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5257
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.