powered by:
Protein Alignment HLH4C and HLH3B
DIOPT Version :9
Sequence 1: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_525055.1 |
Gene: | HLH3B / 31249 |
FlyBaseID: | FBgn0011276 |
Length: | 376 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 32/51 - (62%) |
Similarity: | 38/51 - (74%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 TRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE 165
||||.|.:..:.:|||||||:||.||||||||.|||:.||.||..|..:||
Fly 172 TRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE 222
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH4C | NP_001259243.1 |
HLH |
108..165 |
CDD:238036 |
30/49 (61%) |
HLH3B | NP_525055.1 |
HLH |
171..222 |
CDD:197674 |
30/49 (61%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR13864 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.