DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and ase

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster


Alignment Length:166 Identity:45/166 - (27%)
Similarity:64/166 - (38%) Gaps:47/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NPHLVNEDYAASTTLDIDKRFQARMACETAAQPAPPPPPTPAPRRRTTPIAHLDPSE-------- 90
            |.|.......:.|::...|       |:|..:.|...||      :...|:|...|:        
  Fly    99 NRHNQQNQQLSKTSVPAKK-------CKTNKKLAVERPP------KAGTISHPHKSQSDQSFGTP 150

  Fly    91 -LVGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPD------------K 142
             ..||...:...||.|          |||.||:..|..||.||:.:|....:            |
  Fly   151 GRKGLPLPQAVARRNA----------RERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASK 205

  Fly   143 KLSKIEILKLAICYIAYLNHVLE---TPXDSAGASS 175
            ||||:|.|::|:.||..|..:|.   .| :|.|.||
  Fly   206 KLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 22/68 (32%)
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.