DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and ascl1a

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:163 Identity:43/163 - (26%)
Similarity:69/163 - (42%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DYAASTTLDIDKRFQARMACETAAQPAPPPP----------PTPAPRRRTTPIAHLDPSELVGLS 95
            |..|...:.::::.....||..|:|.....|          ...|.|:|::             |
Zfish     2 DITAKMEISVNQQQFMPPACFFASQSIQLSPTDSQCSNKSASKQAKRQRSS-------------S 53

  Fly    96 REERRRRRRA-------TLKYRTAHAT-----RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIE 148
            .|..|.:||.       :|..:..||.     |||.||:..|..||.||:.:|....:||:||:|
Zfish    54 PELLRCKRRLNFAGFGYSLPQQQPHAVARRNERERNRVKLVNNGFATLREHVPNGAANKKMSKVE 118

  Fly   149 ILKLAICYIAYLNHVLETPXDSAGASSFATSCL 181
            .|:.|:.||..|..:|:  ...|.:::|.:..|
Zfish   119 TLRSAVEYIRALQQLLD--EHDAVSAAFQSGVL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/61 (38%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54 3/33 (9%)
HLH 94..136 CDD:197674 17/43 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.