powered by:
Protein Alignment HLH4C and Tmem9b
DIOPT Version :9
Sequence 1: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017444476.1 |
Gene: | Tmem9b / 293415 |
RGDID: | 1310775 |
Length: | 199 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 10/47 - (21%) |
Similarity: | 18/47 - (38%) |
Gaps: | 14/47 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 IEILKLAICYIAYL--------------NHVLETPXDSAGASSFATS 179
:.||.|.:.|:.|| :.:|::. |......||.:
Rat 110 LSILGLLLLYMVYLTLVEPILKRRLFGHSQLLQSDDDIGDHQPFANA 156
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH4C | NP_001259243.1 |
HLH |
108..165 |
CDD:238036 |
6/31 (19%) |
Tmem9b | XP_017444476.1 |
Tmemb_9 |
58..198 |
CDD:398868 |
10/47 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.