Sequence 1: | NP_001259243.1 | Gene: | HLH4C / 31397 | FlyBaseID: | FBgn0011277 | Length: | 191 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061279.2 | Gene: | Ptf1a / 19213 | MGIID: | 1328312 | Length: | 324 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 56/199 - (28%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 47/199 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 SRYYLVDDDEMIGPNNPHLVNEDYAASTTLDIDKRFQARMACETAAQPAP----PPP-------- 71
Fly 72 -------------------PTPAPRRRTTPIAH-LDPSELVG---------LSREERRRRRRATL 107
Fly 108 -KYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLET--PXD 169
Fly 170 SAGA 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HLH4C | NP_001259243.1 | HLH | 108..165 | CDD:238036 | 25/56 (45%) |
Ptf1a | NP_061279.2 | HLH | 162..217 | CDD:238036 | 25/54 (46%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 302..324 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |