DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and lin-32

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_508410.2 Gene:lin-32 / 191703 WormBaseID:WBGene00003018 Length:142 Species:Caenorhabditis elegans


Alignment Length:102 Identity:36/102 - (35%)
Similarity:56/102 - (54%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TTPIA----HLD----PSELV-GLSREERRRRRR------ATLKYRTAHAT-RERIRVEAFNVSF 128
            |||:.    .||    |..|. |..::::::.||      ..|:.|.:.|. |||.|:...||::
 Worm    28 TTPLQSPNFSLDSPNYPDSLSNGGGKDDKKKCRRYKTPSPQLLRMRRSAANERERRRMNTLNVAY 92

  Fly   129 AELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE 165
            .|||::||.:...|||||.|.|::|..||..|:.:|:
 Worm    93 DELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 24/57 (42%)
lin-32NP_508410.2 HLH 73..124 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.