DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and hlh-15

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_508440.1 Gene:hlh-15 / 183427 WormBaseID:WBGene00001959 Length:89 Species:Caenorhabditis elegans


Alignment Length:72 Identity:48/72 - (66%)
Similarity:64/72 - (88%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIA 158
            ||:.|||:|||||.|||..||||||||||:||::|::||.||||||.:|||||||||:.:|.||:
 Worm    18 LSKAERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAYIS 82

  Fly   159 YLNHVLE 165
            :|:::|:
 Worm    83 FLDNLLQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 37/56 (66%)
hlh-15NP_508440.1 bHLH_TS_HEN 32..88 CDD:381420 37/55 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162116
Domainoid 1 1.000 75 1.000 Domainoid score I5935
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004393
OrthoInspector 1 1.000 - - oto19126
orthoMCL 1 0.900 - - OOG6_109092
Panther 1 1.100 - - LDO PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3713
SonicParanoid 1 1.000 - - X3111
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.