powered by:
Protein Alignment HLH4C and hlh-15
DIOPT Version :9
Sequence 1: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508440.1 |
Gene: | hlh-15 / 183427 |
WormBaseID: | WBGene00001959 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 48/72 - (66%) |
Similarity: | 64/72 - (88%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 LSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIA 158
||:.|||:|||||.|||..||||||||||:||::|::||.||||||.:|||||||||:.:|.||:
Worm 18 LSKAERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAYIS 82
Fly 159 YLNHVLE 165
:|:::|:
Worm 83 FLDNLLQ 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160162116 |
Domainoid |
1 |
1.000 |
75 |
1.000 |
Domainoid score |
I5935 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004393 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto19126 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_109092 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13864 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3713 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3111 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
11 | 10.770 |
|
Return to query results.
Submit another query.