DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Mesp1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:125 Identity:39/125 - (31%)
Similarity:53/125 - (42%) Gaps:28/125 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AQPAPPPPPTPAPRRRT-TPIAHLDPSELVGLSREERRRRRRAT------LKYRTAHATRERIRV 121
            ||.:.|.||...|.||. ||                   .||.|      ...|.:.:.||::|:
Mouse    44 AQASSPAPPCARPARRAGTP-------------------GRRGTHGSRLGSGQRQSASEREKLRM 89

  Fly   122 EAFNVSFAELRKLLP--TLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGASSFATS 179
            .....:..|||:.||  ..|..:.|:|||.|:|||.||.:|:.||... |:......|.|
Mouse    90 RTLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQRHAVS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 22/58 (38%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 15/60 (25%)
HLH 77..130 CDD:278439 20/52 (38%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.