DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Ascl2

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:182 Identity:51/182 - (28%)
Similarity:72/182 - (39%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PHLVNEDYAASTTLDIDKRFQARMACETAAQPAPPPPPT--------PAPRRRTTPIAHLDPSEL 91
            ||.|..::.:....::....|...|........|...||        .|.||:.:|       ||
Mouse    42 PHPVPREHFSCAAPELVAGAQGLNASLMDGGALPRLMPTSSGVAGACAARRRQASP-------EL 99

  Fly    92 VGLSREERRRRRRATLKYRTAHAT-----RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILK 151
            :   |..||||..||....::.|.     |||.||:..|:.|..||:.:|....:|||||:|.|:
Mouse   100 L---RCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLR 161

  Fly   152 LAICYIAYLNHVL------------------ETPXD-----SAGASSFATSC 180
            .|:.||..|..:|                  ..|.|     ||..:|.:.||
Mouse   162 SAVEYIRALQRLLAEHDAVRAALAGGLLTPATPPSDECAQPSASPASASLSC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/79 (29%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 7/21 (33%)
HLH 134..176 CDD:197674 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.