DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Lyl1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:202 Identity:54/202 - (26%)
Similarity:75/202 - (37%) Gaps:81/202 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QARMACETAAQPAPP-PPPTPAP--------RRRTTP----------IAHLDP------------ 88
            :..|.|.::..|||| .|.:|.|        |...||          :.|..|            
Mouse    17 KTEMVCASSPAPAPPSKPASPGPLSTEEVDHRNTCTPWLPPGVPVINLGHTRPIGAAMPTTELSA 81

  Fly    89 -----SELVGLSREE--------------------------------RRRRRRATLKYRTAHA-- 114
                 .:|..|.|..                                :||...:.|.....|.  
Mouse    82 FRPSLLQLTALGRAPPTLAVHYHPHPFLNSVYIGPAGPFSIFPNSRLKRRPSHSELDLADGHQPQ 146

  Fly   115 ---------TRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVL--ETPX 168
                     :|||.|.:..|.:||||||||||.|||:||||.|:|:||:.||.:|..:|  :|..
Mouse   147 KVARRVFTNSRERWRQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQTAV 211

  Fly   169 DSAGASS 175
            .::|.|:
Mouse   212 LTSGPSA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 31/69 (45%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 9/28 (32%)
bHLH_TS_LYL1 145..209 CDD:381548 30/63 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.