DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and Hand1

DIOPT Version :10

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:118 Identity:43/118 - (36%)
Similarity:55/118 - (46%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAPPPPPTPA-------PRRRTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEA 123
            ||..||||.|       |..|.:.    .|..|..|.....:|:.....|        ||.|.|:
Mouse    57 PAGGPPPTTAVAAAAYGPDARPSQ----SPGRLEALGSRLPKRKGSGPKK--------ERRRTES 109

  Fly   124 FNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLETPXDSAGASSF 176
            .|.:|||||:.:|.:|.|.|||||:.|:||..|||||..||.....:....:|
Mouse   110 INSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 28/59 (47%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 17/63 (27%)
bHLH_TS_HAND1 94..153 CDD:381522 30/66 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.