DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and ascl2

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:182 Identity:49/182 - (26%)
Similarity:69/182 - (37%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KRFQARM-----ACETAAQPAPP--PP------------PTPAPRRRTTPIAHL--DPSEL---- 91
            |.||...     ..|..|.|..|  ||            |..|||:    :|:.  .|..|    
 Frog    38 KSFQREQVPSGPTLERKATPVVPVAPPSSAMEEQPGSERPAKAPRK----VANQSGSPQRLRCQR 98

  Fly    92 --------VGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLP-PDKKLSKI 147
                    :|:|....||..            |||.||:..|:.||:||:.:|... |:||:||:
 Frog    99 RSGSLPNAIGISATSERRNE------------RERNRVKLVNLGFAKLRQHVPQAQGPNKKMSKV 151

  Fly   148 EILKLAICYIAYLNHVL--------ETPXDSAGASSFATSCLFNEANFFAPP 191
            |.|:.|:.||..|..:|        :.. .|.|.|...:||..:..:....|
 Frog   152 ETLRSAVEYIRALQSILMERTAGEGQGRAGSDGLSPCGSSCSVDSGSLALSP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/65 (35%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.