DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and tal1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001135468.1 Gene:tal1 / 100196924 XenbaseID:XB-GENE-479827 Length:388 Species:Xenopus tropicalis


Alignment Length:166 Identity:46/166 - (27%)
Similarity:62/166 - (37%) Gaps:60/166 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CETAAQPAPPP---------PPTPAPRR-------------RTTPIAHL---------------- 86
            |...:....||         ||.|.|..             :.:|.|.|                
 Frog   148 CRAPSSVTGPPLTVTTELCRPPIPLPSTGPPAEQAVEARMVQLSPTASLPLQAAGRTMLYGLNQT 212

  Fly    87 ----------DPSELVGLSREERRRRRRATLKYRTAHA------------TRERIRVEAFNVSFA 129
                      ||......:...|.:||....:...:..            :|||.|.:..|.:||
 Frog   213 LASGNSGYFDDPEAYPMFTNNSRVKRRPGPYEVEISEGPQTKVVRRIFTNSRERWRQQNVNGAFA 277

  Fly   130 ELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE 165
            |||||:||.||||||||.|||:||:.||.:|..:|:
 Frog   278 ELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 30/68 (44%)
tal1NP_001135468.1 PHA03247 <6..195 CDD:223021 8/46 (17%)
bHLH_TS_TAL1 254..318 CDD:381549 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.