DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH4C and nhlh1

DIOPT Version :9

Sequence 1:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_002937307.1 Gene:nhlh1 / 100125788 XenbaseID:XB-GENE-989790 Length:128 Species:Xenopus tropicalis


Alignment Length:76 Identity:68/76 - (89%)
Similarity:73/76 - (96%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ELVGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAI 154
            ||..|||||||||||||.||||||||||||||||||::|||||||||||||||||||||||:|||
 Frog    52 ELQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAI 116

  Fly   155 CYIAYLNHVLE 165
            |||:||||||:
 Frog   117 CYISYLNHVLD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 52/56 (93%)
nhlh1XP_002937307.1 bHLH_TS_HEN1 56..127 CDD:381544 65/70 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7161
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004393
OrthoInspector 1 1.000 - - otm48041
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.