DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3062 and Cfap126

DIOPT Version :9

Sequence 1:NP_572177.2 Gene:CG3062 / 31396 FlyBaseID:FBgn0025612 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001074744.1 Gene:Cfap126 / 75472 MGIID:1922722 Length:189 Species:Mus musculus


Alignment Length:240 Identity:58/240 - (24%)
Similarity:88/240 - (36%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALHFSAQQFEGRFQSKRLNNWEYPRFSPPRPRGLQKNA------KVVAANNGHLLPEVIK-EGN 58
            ||.::||.|:|..:....|.||     ||.||. .:|.|      :::|.:.|||||.|.: :.:
Mouse     1 MATNYSANQYEKAYLPTYLQNW-----SPARPT-KEKIAAHEGYTQIIANDRGHLLPSVPRSKAS 59

  Fly    59 SFGQYRGTYELPRRITRA---FCAHYDACLSGRYKFVDFPRDLCNCQRENRRALACDQRLTLGHK 120
            .:|.:.||:::|.:|..|   ..|..........|::....||.|.....|..::       |..
Mouse    60 PWGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEIS-------GKP 117

  Fly   121 DDPYWMRERCQTKCEGLQKLRALSERSARCNRAKCDVVSEKTVKMTPKAIKTTGVATEKRRRKRT 185
            .||     ..|||          .::|.           .|||:..|..               |
Mouse   118 FDP-----DSQTK----------QKKSV-----------TKTVQQAPNP---------------T 141

  Fly   186 ITAFSKGRTALHPNELTKPIPSSEKPAA----TVATPKDKPKDKP 226
            |...|......:|:|     |.|..|:|    ...||.:.|.:.|
Mouse   142 IIPSSPVIQGDNPDE-----PQSSHPSAGHTPGPQTPVNSPNNPP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3062NP_572177.2 None
Cfap126NP_001074744.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..189 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009252
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110598
Panther 1 1.100 - - LDO PTHR34639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5936
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.730

Return to query results.
Submit another query.