DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3062 and Cfap126

DIOPT Version :9

Sequence 1:NP_572177.2 Gene:CG3062 / 31396 FlyBaseID:FBgn0025612 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001102545.1 Gene:Cfap126 / 498278 RGDID:1562658 Length:185 Species:Rattus norvegicus


Alignment Length:249 Identity:53/249 - (21%)
Similarity:92/249 - (36%) Gaps:91/249 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALHFSAQQFEGRFQSKRLNNWEYPRFSPPRPRGLQKNA------KVVAANNGHLLPEVIK-EGN 58
            ||.::||.|:|..:..:.|.||     ||.:|. .:|.|      :::|.:.|||||.|.: :.:
  Rat     1 MATNYSANQYERAYLPRYLQNW-----SPAKPT-KEKIATHEGYTQIIANDRGHLLPSVPRSKAS 59

  Fly    59 SFGQYRGTYELPRRITRA---FCAHYDACLSGRYKFVDFPRDLCNCQRENRRALACDQRLTLGHK 120
            .:|.|.||:::|.:|..|   ..|...|......:::....||.|.                   
  Rat    60 PWGSYIGTWQMPLKIPPAKANLTARTTAAADSLTEWIHKNPDLLNA------------------- 105

  Fly   121 DDPYWMRERCQTKCEGLQKLRALSERSARCNRAKCDVVSEKTVKMTPKAIKTTGVATEKRRRKRT 185
                         |.||:                            |:.|........::::|::
  Rat   106 -------------CNGLR----------------------------PEIIGKPRDLNSQKKQKKS 129

  Fly   186 ITAFSKGRTALHPNEL-TKPI--------PSSEKPAA----TVATPKDKPKDKP 226
            :|  ...:.||:|..: :.|:        |.|..|:|    ...||.:.||:.|
  Rat   130 VT--KTVQQALNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPLNSPKNPP 181



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487116at2759
OrthoFinder 1 1.000 - - FOG0009252
OrthoInspector 1 1.000 - - oto97520
orthoMCL 1 0.900 - - OOG6_110598
Panther 1 1.100 - - LDO PTHR34639
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.