DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3062 and CFAP126

DIOPT Version :9

Sequence 1:NP_572177.2 Gene:CG3062 / 31396 FlyBaseID:FBgn0025612 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001013647.2 Gene:CFAP126 / 257177 HGNCID:32325 Length:177 Species:Homo sapiens


Alignment Length:227 Identity:54/227 - (23%)
Similarity:85/227 - (37%) Gaps:67/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALHFSAQQFEGRFQSKRLNNWEYPRFSPPRP-----RGLQKNAKVVAANNGHLLPEVIK-EGNS 59
            ||.::||.|:|..|.||.|.||     ||.:|     ...:...:::|.:.|||||.|.: :.|.
Human     1 MATNYSANQYEKAFSSKYLQNW-----SPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANP 60

  Fly    60 FGQYRGTYELPRRITRA---FCAHYDACLSGRYKFVDFPRDLCNCQRENRRALACDQRLTLGHKD 121
            :|.:.||:::|.:|..|   ..:...|..:...|::....||......     .|.:  .||...
Human    61 WGSFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNG-----LCPE--ILGKPH 118

  Fly   122 DPYWMRERCQTKCEGLQKLRALSERSARCNRAKCDVVSEKTVKMTPKAIKTTGVATEKRRRKRTI 186
            ||           :..:|||                             |.:...|.::.|..||
Human   119 DP-----------DSQKKLR-----------------------------KKSITKTVQQARSPTI 143

  Fly   187 TAFSKGRTALHPNELTKPIPSS------EKPA 212
            ...|.......|:||....||:      ::||
Human   144 IPSSPAANLNSPDELQSSHPSAGHTPGPQRPA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3062NP_572177.2 None
CFAP126NP_001013647.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..177 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487116at2759
OrthoFinder 1 1.000 - - FOG0009252
OrthoInspector 1 1.000 - - oto90407
orthoMCL 1 0.900 - - OOG6_110598
Panther 1 1.100 - - LDO PTHR34639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5936
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.