DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3062 and cfap126

DIOPT Version :9

Sequence 1:NP_572177.2 Gene:CG3062 / 31396 FlyBaseID:FBgn0025612 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_031747829.1 Gene:cfap126 / 100495280 XenbaseID:XB-GENE-6460234 Length:151 Species:Xenopus tropicalis


Alignment Length:182 Identity:45/182 - (24%)
Similarity:71/182 - (39%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALHFSAQQFEGRFQSKRLNNWEYPRFSPPRPRGLQKNAKVVAANNGHLLPEVIK-EGNSFGQYR 64
            ||.|:||.|::..|..|:|.:|..|:....||.......:.:|...|||||.|.: :.|.:|.:.
 Frog     1 MATHYSANQYQSAFTPKQLQSWNVPKAYKERPSDHDGYTQFIANERGHLLPGVPRSQKNPWGTFI 65

  Fly    65 GTYELPRRITRAFCAHYDACLSGRYKFVDFPRDLCNCQRENRRALACDQRLTLGHKDDPYWMR-- 127
            ||::||.:|..:                       .....:|.|:| .:|||       .|::  
 Frog    66 GTWDLPTKIPPS-----------------------KVSLTSRSAVA-SRRLT-------NWIQNS 99

  Fly   128 ERCQTKCEGL------------QKLRALSERSARCNRAKCDVVSEKTVKMTP 167
            |...:.|.||            ..||..||.:.:          ||..:.:|
 Frog   100 EALLSACNGLHPHISGKASGQTHSLRDSSEETQQ----------EKAKQTSP 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487116at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.