DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12684 and CG15708

DIOPT Version :9

Sequence 1:NP_572173.1 Gene:CG12684 / 31390 FlyBaseID:FBgn0029717 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_611104.3 Gene:CG15708 / 36805 FlyBaseID:FBgn0034099 Length:250 Species:Drosophila melanogaster


Alignment Length:241 Identity:79/241 - (32%)
Similarity:134/241 - (55%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKQNVQKD--QCVRCLHCKKVIQCSRFDSGGLLRHIEYEHPELFTMARSKLRNVYNPSTDQSYW 63
            ||:.|.:..  |.:|||||.|||:|||:|:..|:|||:.:|||::.:...|::|::..:.|....
  Fly     1 MSQTNPKPSDTQSLRCLHCMKVIRCSRYDTSELVRHIQQDHPEIYAVTTDKIKNLHKLAADHGIS 65

  Fly    64 ACEVRK-RMMSNVSDSEL---NSQNLGRCKNKKRTSSDSISKKSSTAKCNVAAANYSCPHSKAKN 124
            ...:.| ..|:.:|:|::   ..:.:.:.||..|:........::.::    ||:|.   ::..:
  Fly    66 EERLSKISKMTGLSESQMAEKAEKYMAKKKNYGRSGGSVAGDPAAVSE----AASYK---TEKPS 123

  Fly   125 STCPKARTNGPCSPHHMIFRKMAYKSSARRWCAMDGSIFCPACGYKKRPVVKCASGWNSRWC--- 186
            |.||.:|.....:.|    |:..|::|..||...:|.||||.|...:||::|.|:..::..|   
  Fly   124 SPCPCSRPLENSTSH----RRKCYRASIERWAPAEGRIFCPCCATSRRPLIKAATEISNNGCCAA 184

  Fly   187 ----SWAFCFMPCLKSSDNGENIYCGHCNTFLGAFNREKQSLKPNK 228
                .|..||:|||.|:||.|.:||.:|..|||.:||||..::|:|
  Fly   185 WVVSCWPLCFLPCLMSADNNEYLYCANCRAFLGIYNREKSCVQPSK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12684NP_572173.1 LITAF 159..219 CDD:197841 27/66 (41%)
CG15708NP_611104.3 LITAF 155..221 CDD:197841 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I7375
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25888
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016878
OrthoInspector 1 1.000 - - otm49789
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.