DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11444 and AT5G46020

DIOPT Version :9

Sequence 1:NP_001284863.1 Gene:CG11444 / 31388 FlyBaseID:FBgn0029715 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_568653.1 Gene:AT5G46020 / 834642 AraportID:AT5G46020 Length:164 Species:Arabidopsis thaliana


Alignment Length:215 Identity:83/215 - (38%)
Similarity:108/215 - (50%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKASSSASKAKAPATRKA 65
            |.||||.......|.|:|                          ||...|.:||::.::...::|
plant     1 MGRGKFKGKPTGQRRFSS--------------------------AADILAGTSAARPRSFKQKEA 39

  Fly    66 PVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAEARDAKKGVASLIEIENPNRVTKKATQKLSA 130
            ....:              .|.||.|:|:::||.||...|||..::||::|||||.:|.   |.|
plant    40 EYEED--------------VEEESEEESEEESEDEADVKKKGAEAVIEVDNPNRVRQKT---LKA 87

  Fly   131 IKLDDGPAGAGGNPKPELSRREREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEAA 195
            ..||       .:...||||||||::|||||.:||.:|...|||.:|:.||.|||||||||||||
plant    88 KDLD-------ASKTTELSRREREELEKQRAHERYMRLQEQGKTEQARKDLDRLALIRQQREEAA 145

  Fly   196 AKREAEKKAADVGTKKPGAK 215
            .|||.||.|.| ..|..|.|
plant   146 KKREEEKAARD-AKKVEGRK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11444NP_001284863.1 PP28 115..190 CDD:287254 38/74 (51%)
AT5G46020NP_568653.1 PP28 76..140 CDD:402043 38/73 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2851
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2019
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm2952
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - LDO PTHR22055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.