DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11444 and pdap1b

DIOPT Version :9

Sequence 1:NP_001284863.1 Gene:CG11444 / 31388 FlyBaseID:FBgn0029715 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956504.1 Gene:pdap1b / 393179 ZFINID:ZDB-GENE-040426-942 Length:178 Species:Danio rerio


Alignment Length:207 Identity:86/207 - (41%)
Similarity:123/207 - (59%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPR-GKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKASSSASKAKAPATRK 64
            ||: ||...||||.|.:|||||:..:.:.:.::.    .:.:::.||                  
Zfish     1 MPKGGKKGGHKGRMRTYTSPEEIDAQMKAEKERK----KNEEEEGAA------------------ 43

  Fly    65 APVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAEARDAKKGVASLIEIENPNRVTKKATQKLS 129
              ||.||.......:|:         ||||||...:    :|||..|||||||||:.:|| :|::
Zfish    44 --VNDNQSEDKLTASGS---------EDSDDDGSQK----RKGVEGLIEIENPNRIAQKA-KKVT 92

  Fly   130 AIKLDDGPAGAGGNPKPELSRREREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEA 194
            .|:| :||        .:|||||||:||||:|::||.|:|.||:|.:|||||||||:||:|||||
Zfish    93 EIEL-EGP--------KQLSRREREEIEKQKAKERYMKMHLAGETDQAKADLARLAIIRKQREEA 148

  Fly   195 AAKREAEKKAAD 206
            |.|::.|:||.:
Zfish   149 ARKKDEERKAKE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11444NP_001284863.1 PP28 115..190 CDD:287254 42/74 (57%)
pdap1bNP_956504.1 PP28 79..152 CDD:287254 48/82 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589976
Domainoid 1 1.000 95 1.000 Domainoid score I7343
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4564
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - mtm6599
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - LDO PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.