DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11444 and PDAP1

DIOPT Version :9

Sequence 1:NP_001284863.1 Gene:CG11444 / 31388 FlyBaseID:FBgn0029715 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_055706.1 Gene:PDAP1 / 11333 HGNCID:14634 Length:181 Species:Homo sapiens


Alignment Length:221 Identity:96/221 - (43%)
Similarity:121/221 - (54%) Gaps:65/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPR-GKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKASSSASKAKAPATRK 64
            ||: |:...||||:|.:|||||:.                          |...|.|.||     
Human     1 MPKGGRKGGHKGRARQYTSPEEID--------------------------AQLQAEKQKA----- 34

  Fly    65 APVNRNQKSRSAAGAGAA-------SSSESESGEDSDDDSEAEARDAKKGVASLIEIENPNRV-- 120
                |.::.:...|.|||       .|.:|:..||.:||.:.:    :|||..||:|||||||  
Human    35 ----REEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQK----RKGVEGLIDIENPNRVAQ 91

  Fly   121 -TKKATQKLSAIKLD-DGPAGAGGNPKPELSRREREQIEKQRARQRYEKLHAAGKTTEAKADLAR 183
             |||.||      || |||        .||||||||:||||:|::||.|:|.||||.:|||||||
Human    92 TTKKVTQ------LDLDGP--------KELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLAR 142

  Fly   184 LALIRQQREEAAAKREAEKKAADVGT 209
            ||:||:||||||.|:|.|:||.|..|
Human   143 LAIIRKQREEAARKKEEERKAKDDAT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11444NP_001284863.1 PP28 115..190 CDD:287254 48/78 (62%)
PDAP1NP_055706.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 60/168 (36%)
PP28 85..149 CDD:402043 47/77 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..181 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154939
Domainoid 1 1.000 96 1.000 Domainoid score I7340
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4548
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm40620
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - LDO PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.